Difference between revisions of "CSC334 Lab2"

From dftwiki3
Jump to: navigation, search
Line 9: Line 9:
 
[[Image:CSC334_Lab2_1.png | thumb | 300 px | frame | Figure 1]]
 
[[Image:CSC334_Lab2_1.png | thumb | 300 px | frame | Figure 1]]
  
 +
<br />
 +
<br />
 +
<br />
 
<br />
 
<br />
 
<br />
 
<br />

Revision as of 17:04, 21 July 2008

Retrieving Protein sequences from ExPASy

ExPASy is a database of proteins created by a pioneer of bioinformatics: Amos Bairoch

Methodology


Figure 1






  • Find the Sequence Information at the bottom of the page, and select P06968 in FASTA format for the display. You should get something like this:
>sp|P06968|DUT_ECOLI Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Escherichia coli (strain K12) GN=dut PE=1 SV=1
MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIAD
PSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMI
FVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ