CSC334 Lab2

Back to CSC334 Lab Page

---

Retrieving Protein sequences from ExPASy

ExPASy is a database of proteins created by a pioneer of bioinformatics: Amos Bairoch

Methodology

• Point your browser to www.expasy.org/sprot/ and enter DUT_ECOLI in the search bar and click on Go:

Figure 1

• The Accession Number of the protein found is P06968. Its name in the Swiss-Prot database is DUT_ECOLI, but it is also known as EC 3.6.1.23, or dUTPase, or dUTP pyrophospatase.

• Find the Sequence Information at the bottom of the page, and select P06968 in FASTA format for the display. You should get something like this:

>sp|P06968|DUT_ECOLI Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Escherichia coli (strain K12) GN=dut PE=1 SV=1
MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIAD
PSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMI
FVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ

---

Back to CSC334 Lab Page
© D. Thiebaut 2008